PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG005200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 458aa    MW: 50971.8 Da    PI: 8.4477
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG005200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.82.9e-283786251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         rie+ + rqvtfskRrng+lKKA+ELSvLCdaeva+i++s++g+ly +ss
  Pavir.1KG005200.1.p 37 RIEDATSRQVTFSKRRNGLLKKAYELSVLCDAEVALIVVSPSGRLYQFSS 86
                         8***********************************************96 PP

2K-box82.97.1e-28106200599
                K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          ++++++e   e+++ e++ L ++i+ ++ ++R+llGe+L+s+s++eLq+Le qLeksl++iR++K++ l++qi el++ke++l +en +L
  Pavir.1KG005200.1.p 106 TNERVDEPGVEKWKYEATTLGQKIDAIEASKRNLLGESLGSCSIQELQELELQLEKSLSSIRQRKQKKLMDQILELREKEQKLAKENAML 195
                          4556889999******************************************************************************** PP

                K-box  95 rkkle 99 
                          r + +
  Pavir.1KG005200.1.p 196 RDQCK 200
                          *9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.6462888IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-362887IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-2930119IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003084IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-273050IPR002100Transcription factor, MADS-box
PfamPF003192.0E-263784IPR002100Transcription factor, MADS-box
CDDcd002652.79E-333898No hitNo description
PRINTSPR004044.2E-275065IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-276586IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.757115205IPR002487Transcription factor, K-box
PfamPF014864.0E-27115199IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MVATAAAAAA PDERQIVPSD ASRMKKQGRR GRREMRRIED ATSRQVTFSK RRNGLLKKAY  60
ELSVLCDAEV ALIVVSPSGR LYQFSSATDL QNTIDRYLYH TKGTPTNERV DEPGVEKWKY  120
EATTLGQKID AIEASKRNLL GESLGSCSIQ ELQELELQLE KSLSSIRQRK QKKLMDQILE  180
LREKEQKLAK ENAMLRDQCK ALPLLELNDK GHMDAAAAGG EEEEAADDGL VMDKTIMSNQ  240
AGKVLKKGKK KQAKDELDRQ KQAEKKRRRL EKALANSAAI ISELEKKKQK RKEERQRLDE  300
EGAAIAEAVA LHVLIGEDSD EPCHLMLNKH RRCSHWDPSA GFEFTVDPQT TDIYSSDGLI  360
CTSHAYAPKG RWADWGIGQP LPSWGEVRDL QVQGPYYQGT FHQSVNCPGF IAAQAVSSLQ  420
IREDSSEIAS PSQGAAAATV VNRMLGGANR LNLYREI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-153097268Myocyte-specific enhancer factor 2A
3mu6_C1e-153097268Myocyte-specific enhancer factor 2A
3mu6_B1e-153097268Myocyte-specific enhancer factor 2A
3mu6_A1e-153097268Myocyte-specific enhancer factor 2A
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1248268KKKQAKDELDRQKQAEKKRRR
2265269KRRRL
3266289RRRLEKALANSAAIISELEKKKQK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.52470.0callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3Z0C20.0K3Z0C2_SETIT; Uncharacterized protein
STRINGSi019985m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38051616
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-52AGAMOUS-like 20